Syndecan-2/CD362 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258489

Catalog No. NBP258489

Description

Syndecan-2/CD362 Polyclonal specifically detects Syndecan-2/CD362 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Syndecan-2/CD362
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CD362 antigen, fibroglycan, heparan sulfate proteoglycan 1, cell surface-associated, Heparan sulfate proteoglycan core protein, HSPG, HSPG1syndecan proteoglycan 2, SYND2cell surface-associated heparan sulfate proteoglycan 1, syndecan 2, syndecan-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SDC2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVL
• Quantity: 100 μL
• Research Discipline: Extracellular Matrix
• Gene ID (Entrez): 6383
• Target Species: Human
• Isotype: IgG

For Research Use Only