Syntabulin/GOLSYN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230921

Catalog No. NBP230921

Description

Syntabulin/GOLSYN Polyclonal specifically detects Syntabulin/GOLSYN in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Syntabulin/GOLSYN
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9NX95
• Gene Symbols: SYBU
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STPGANVLELLPIVMGQEEGSVVVERAVQTDVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALVVDLTPRNPNSAI
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Golgi-Localized Protein, Golgi-Localized Syntaphilin-Related Protein, GOLSYN A Protein, GOLSYN B Protein, GOLSYN C Protein, Implicated In Syntaxin Trafficking In Neurons, KIAA1472, Microtubule-Associated Protein, OCSYN, SNPHL, SYBU, syntabulin, Syntabulin (Syntaxin-Interacting), syntaphilin-like, Syntaxin-1-Binding Protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55638
• Target Species: Human
• Isotype: IgG

For Research Use Only