Syntabulin/GOLSYN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397644	Novus Biologicals NBP23092125UL	25 μL
NBP230921	Novus Biologicals NBP230921	0.1 mL

Description

Syntabulin/GOLSYN Polyclonal specifically detects Syntabulin/GOLSYN in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Syntabulin/GOLSYN
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Golgi-Localized Protein, Golgi-Localized Syntaphilin-Related Protein, GOLSYN A Protein, GOLSYN B Protein, GOLSYN C Protein, Implicated In Syntaxin Trafficking In Neurons, KIAA1472, Microtubule-Associated Protein, OCSYN, SNPHL, SYBU, syntabulin, Syntabulin (Syntaxin-Interacting), syntaphilin-like, Syntaxin-1-Binding Protein
• Gene Symbols: SYBU
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q9NX95
• Gene ID (Entrez): 55638
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STPGANVLELLPIVMGQEEGSVVVERAVQTDVVPYSPAISELIQSVLQKLQDPCPSSLASPDESEPDSMESFPESLSALVVDLTPRNPNSAI
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only