Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16910420

Syntaxin 1A Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
SDP

Catalog No. NBP16910420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16910420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16910420 Supplier Novus Biologicals Supplier No. NBP16910420UL

Description

Rabbit Polyclonal Antibody

Synaptotagmin 5 Polyclonal specifically detects Synaptotagmin 5 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Synaptotagmin 5
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias synaptotagmin Vsynaptotagmin 5, synaptotagmin-5, sytV
Gene Symbols SYT5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SYT5 (synaptotagmin V) The peptide sequence was selected form the middle region of SYT5. Peptide sequence YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Membrane Vesicle Markers
Primary or Secondary Primary
Gene ID (Entrez) 6861
Target Species Human, Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.