Syntenin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158969

Catalog No. NBP158969

Description

Syntenin 2 Polyclonal specifically detects Syntenin 2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Syntenin 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ12256, SITAC18ST-2, syndecan binding protein (syntenin) 2, Syndecan-binding protein 2, syntenin-2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 92%; Equine: 92%; Pig: 92%; Rat: 91%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H190-3
• Gene Symbols: SDCBP2
• Immunogen: Synthetic peptides corresponding to SDCBP2(syndecan binding protein (syntenin) 2) The peptide sequence was selected from the N terminal of SDCBP2. Peptide sequence VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ.
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 27111
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.