Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Syntenin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | Syntenin 2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15896920
![]() |
Novus Biologicals
NBP15896920UL |
20 μL |
Each for $158.00
|
|
|||||
NBP158969
![]() |
Novus Biologicals
NBP158969 |
100 μL |
Each for $487.50
|
|
|||||
Description
Syntenin 2 Polyclonal specifically detects Syntenin 2 in Human samples. It is validated for Western Blot.Specifications
Syntenin 2 | |
Polyclonal | |
Rabbit | |
Neuroscience | |
FLJ12256, SITAC18ST-2, syndecan binding protein (syntenin) 2, Syndecan-binding protein 2, syntenin-2 | |
SDCBP2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9H190-3 | |
27111 | |
Synthetic peptides corresponding to SDCBP2(syndecan binding protein (syntenin) 2) The peptide sequence was selected from the N terminal of SDCBP2. Peptide sequence VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title