T-box 19 Antibody (CL6251), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP261438

Catalog No. NBP261438

Description

T-box 19 Monoclonal specifically detects T-box 19 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: T-box 19
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TBX19
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG
• Quantity: 100 μL
• Gene ID (Entrez): 9095
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry (Paraffin)
• Clone: CL6251
• Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: dJ747L4.1, FLJ26302, FLJ34085, T-box 19, T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBS 19, TBS19, TPITFLJ34543
• Host Species: Mouse
• Purification Method: Protein A purified
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1