Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. T-box 19 Antibody (CL6251), Novus Biologicals™

T-box 19 Antibody (CL6251), Novus Biologicals™
SDP

Catalog No. NBP261438 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP261438 100 μL
NB393100 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP261438 Supplier Novus Biologicals Supplier No. NBP261438
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

T-box 19 Monoclonal specifically detects T-box 19 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen T-box 19
Applications Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL6251
Conjugate Unconjugated
Dilution Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias dJ747L4.1, FLJ26302, FLJ34085, T-box 19, T-box factor, pituitary, T-box protein 19, T-box transcription factor TBX19, TBS 19, TBS19, TPITFLJ34543
Gene Symbols TBX19
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EVHASTPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAGWGGPGAGGHHSPSSLDG
Purification Method Protein A purified
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 9095
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.