Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAB1 Antibody, Novus Biologicals™
SDP

Catalog No. NB396657 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396657 25 μL
NBP238819 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396657 Supplier Novus Biologicals Supplier No. NBP23881925UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TAB1 Polyclonal specifically detects TAB1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TAB1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q15750
Gene Alias MAP3K7IP13'-Tab1, MGC57664, mitogen-activated protein kinase kinase kinase 7 interacting protein 1, Mitogen-activated protein kinase kinase kinase 7-interacting protein 1, TAK1-binding protein 1, TGF-beta activated kinase 1/MAP3K7 binding protein 1, TGF-beta-activated kinase 1 and MAP3K7-binding protein 1, TGF-beta-activated kinase 1-binding protein 1, transforming growth factor beta-activated kinase-binding protein 1
Gene Symbols TAB1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 10454
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.