TADA1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156629

Catalog No. NBP156629

Description

TADA1L Polyclonal specifically detects TADA1L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TADA1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADA1, hADA1, HFI1, SPT3-associated factor 42, SPT3-associated factor 42 (STAF42), STAF42transcriptional adaptor 1 (HFI1 homolog, yeast)-like, TADA1LRP1-9E21.4, transcriptional adapter 1, Transcriptional adapter 1-like protein, transcriptional adaptor 1, transcriptional adaptor 1 (HFI1 homolog, yeast)
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Sumatran orangutan: 100%; Canine: 100%; Rat: 100%; Chicken: 92%; Green puffer: 84%; Western clawed frog: 78%; Xenopus: 78%; Zebrafish: 75%;.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96BN2
• Gene Symbols: TADA1
• Immunogen: Synthetic peptides corresponding to TADA1L(transcriptional adaptor 1 (HFI1 homolog, yeast)-like) The peptide sequence was selected from the C terminal of TADA1L (NP_444281). Peptide sequence REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 117143
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.