Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TADA1L Antibody, Novus Biologicals™

TADA1L Antibody, Novus Biologicals™
SDP

Catalog No. NBP15662920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15662920 20 μL
NBP156629 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15662920 Supplier Novus Biologicals Supplier No. NBP15662920UL

Description

Rabbit Polyclonal Antibody

TADA1L Polyclonal specifically detects TADA1L in Human samples. It is validated for Western Blot.

Specifications

Antigen TADA1L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96BN2
Gene Alias ADA1, hADA1, HFI1, SPT3-associated factor 42, SPT3-associated factor 42 (STAF42), STAF42transcriptional adaptor 1 (HFI1 homolog, yeast)-like, TADA1LRP1-9E21.4, transcriptional adapter 1, Transcriptional adapter 1-like protein, transcriptional adaptor 1, transcriptional adaptor 1 (HFI1 homolog, yeast)
Gene Symbols TADA1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TADA1L(transcriptional adaptor 1 (HFI1 homolog, yeast)-like) The peptide sequence was selected from the C terminal of TADA1L (NP_444281). Peptide sequence REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC.
Molecular Weight of Antigen 37 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 117143
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.