TADA1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15662920UL

Catalog No. NBP15662920

Description

TADA1L Polyclonal specifically detects TADA1L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TADA1L
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: Q96BN2
• Gene Symbols: TADA1
• Immunogen: Synthetic peptides corresponding to TADA1L(transcriptional adaptor 1 (HFI1 homolog, yeast)-like) The peptide sequence was selected from the C terminal of TADA1L (NP_444281). Peptide sequence REVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 117143
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ADA1, hADA1, HFI1, SPT3-associated factor 42, SPT3-associated factor 42 (STAF42), STAF42transcriptional adaptor 1 (HFI1 homolog, yeast)-like, TADA1LRP1-9E21.4, transcriptional adapter 1, Transcriptional adapter 1-like protein, transcriptional adaptor 1, transcriptional adaptor 1 (HFI1 homolog, yeast)
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG