TAF15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257720

Catalog No. NBP257720

Description

TAF15 Polyclonal specifically detects TAF15 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.

Specifications

• Antigen: TAF15
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: 68kDa, hTAFII68, Npl3, RBP56TAFII68, RNA-binding protein 56, TAF(II)68, TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2NRBP56/CSMF fusion, TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-binding protein 56), TATA box-binding protein-associated factor 2N (RNA-binding protein 56), TATA-binding protein-associated factor 2N, TBP-associated factor 15,68 kDa TATA-binding protein-associated factor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TAF15
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY
• Quantity: 100 μL
• Research Discipline: DNA Repair, Neuroscience
• Gene ID (Entrez): 8148
• Target Species: Human
• Isotype: IgG

For Research Use Only