Learn More
Description
Specifications
Specifications
| Antigen | TAF15 |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | 68kDa, hTAFII68, Npl3, RBP56TAFII68, RNA-binding protein 56, TAF(II)68, TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2NRBP56/CSMF fusion, TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-binding protein 56), TATA box-binding protein-associated factor 2N (RNA-binding protein 56), TATA-binding protein-associated factor 2N, TBP-associated factor 15,68 kDa TATA-binding protein-associated factor |
| Gene Symbols | TAF15 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
