Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | TAF15 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TAF15 Polyclonal specifically detects TAF15 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
| TAF15 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Neuroscience | |
| 68kDa, hTAFII68, Npl3, RBP56TAFII68, RNA-binding protein 56, TAF(II)68, TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2NRBP56/CSMF fusion, TATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD(RNA-binding protein 56), TATA box-binding protein-associated factor 2N (RNA-binding protein 56), TATA-binding protein-associated factor 2N, TBP-associated factor 15,68 kDa TATA-binding protein-associated factor | |
| TAF15 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown | |
| Unconjugated | |
| RUO | |
| Human | |
| 8148 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SYGQSQSGYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title