Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TAF1C Antibody, Novus Biologicals™

TAF1C Antibody, Novus Biologicals™
SDP

Catalog No. NB393249 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB393249 25 μL
NBP258841 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB393249 Supplier Novus Biologicals Supplier No. NBP25884125UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TAF1C Polyclonal specifically detects TAF1C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen TAF1C
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Alias MGC:39976, RNA polymerase I-specific TBP-associated factor 110 kDa, SL1, 110kD subunit, SL1TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD, TAFI110TBP-associated factor 1C, TAFI95, TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa, TATA box-binding protein-associated factor 1C, TATA box-binding protein-associated factor RNA polymerase I subunit C, transcription factor SL1, Transcription initiation factor SL1/TIF-IB subunit C
Gene Symbols TAF1C
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9013
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.