Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF1C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TAF1C |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TAF1C Polyclonal specifically detects TAF1C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TAF1C | |
Polyclonal | |
Rabbit | |
Human | |
9013 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
MGC:39976, RNA polymerase I-specific TBP-associated factor 110 kDa, SL1, 110kD subunit, SL1TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD, TAFI110TBP-associated factor 1C, TAFI95, TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa, TATA box-binding protein-associated factor 1C, TATA box-binding protein-associated factor RNA polymerase I subunit C, transcription factor SL1, Transcription initiation factor SL1/TIF-IB subunit C | |
TAF1C | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title