Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25754625UL
Description
TAF5L Polyclonal specifically detects TAF5L in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
TAF5L | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
PAF65BPAF65-beta, PCAF associated factor 65 beta, PCAF-associated factor 65 beta, TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 5L, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa | |
Rabbit | |
Affinity Purified | |
RUO | |
27097 | |
Human | |
Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TAF5L | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction