Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF5L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | TAF5L |
---|---|
Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL |
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
TAF5L Polyclonal specifically detects TAF5L in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
TAF5L | |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
27097 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
Polyclonal | |
Rabbit | |
Human | |
PAF65BPAF65-beta, PCAF associated factor 65 beta, PCAF-associated factor 65 beta, TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 5L, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa | |
TAF5L | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title