Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF6L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP174133
Description
TAF6L Polyclonal specifically detects TAF6L in Rat samples. It is validated for Western Blot.Specifications
TAF6L | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
FLJ11136, p300/CBP-associated factor (PCAF)-associated factor 65, PAF65-alpha, PAF65AMGC4288, PCAF-associated factor 65 alpha, PCAF-associated factor 65-alpha, TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa | |
Rabbit | |
68 kDa | |
100 μL | |
Primary | |
This product is specific to Subunit or Isoform: 6L. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
B5DF37 | |
TAF6L | |
Synthetic peptides corresponding to the middle region of Taf6l. Immunizing peptide sequence PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS. | |
Affinity purified | |
RUO | |
10629 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction