Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF6L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TAF6L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TAF6L Polyclonal specifically detects TAF6L in Rat samples. It is validated for Western Blot.Specifications
| TAF6L | |
| Polyclonal | |
| Rabbit | |
| B5DF37 | |
| 10629 | |
| Synthetic peptides corresponding to the middle region of Taf6l. Immunizing peptide sequence PQLMKVALQDLQTNSKIAALLPYFVYVVSGVKSVSHDLEQLHRLLQVARS. | |
| Primary | |
| 68 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ11136, p300/CBP-associated factor (PCAF)-associated factor 65, PAF65-alpha, PAF65AMGC4288, PCAF-associated factor 65 alpha, PCAF-associated factor 65-alpha, TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa | |
| TAF6L | |
| IgG | |
| This product is specific to Subunit or Isoform: 6L. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title