Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF6L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23908325UL
Description
TAF6L Polyclonal specifically detects TAF6L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TAF6L | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q9Y6J9 | |
TAF6L | |
This antibody was developed against a recombinant protein corresponding to amino acids: LCCHYGAVVGLHALGWKAVERVLYPHLSTYWTNLQAVLDDYSVSNAQVKADGHKVYGAILVAVERLLKMKAQAAEPNRGGP | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FLJ11136, p300/CBP-associated factor (PCAF)-associated factor 65, PAF65-alpha, PAF65AMGC4288, PCAF-associated factor 65 alpha, PCAF-associated factor 65-alpha, TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 6L, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa | |
Rabbit | |
Affinity Purified | |
RUO | |
10629 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction