Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAFA3/FAM19A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159502
Description
TAFA3/FAM19A3 Polyclonal specifically detects TAFA3/FAM19A3 in Human samples. It is validated for Western Blot.Specifications
TAFA3/FAM19A3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Chemokine-like protein TAFA-3, family with sequence similarity 19 (chemokine (C-C motif)-like), member A3, MGC138473, TAFA3, TAFA-3 | |
Rabbit | |
Affinity purified | |
RUO | |
284467 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q2M1P9 | |
FAM19A3 | |
Synthetic peptides corresponding to FAM19A3(family with sequence similarity 19 (chemokine (C-C motif)-like), member A3) The peptide sequence was selected from the middle region of FAM19A3. Peptide sequence FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Equine: 92%; Chicken: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction