Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TAK1L Antibody, Novus Biologicals™

TAK1L Antibody, Novus Biologicals™
SDP

Catalog No. NBP15667820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15667820 20 μL
NBP156678 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15667820 Supplier Novus Biologicals Supplier No. NBP15667820UL

Description

Rabbit Polyclonal Antibody

TAK1L Polyclonal specifically detects TAK1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TAK1L
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P57077
Gene Alias chromosome 21 open reading frame 7, HC21ORF7, putative gene, TGF-beta-activated kinase like10TAK1LTAK1-like protein, TAK1-like protein 1, TAK1-like protein 2, TAK1-like protein 4, TAKL, TAKL-1, TAKL-2, TAKL-4, TGF-beta activated kinase
Gene Symbols C21ORF7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TAK1L The peptide sequence was selected from the C terminal of TAK1L. Peptide sequence DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56911
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.