Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TANGO2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17046320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17046320 20 μL
NBP170463 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17046320 Supplier Novus Biologicals Supplier No. NBP17046320UL

Rabbit Polyclonal Antibody

TANGO2 Polyclonal specifically detects TANGO2 in Human samples. It is validated for Western Blot.

Specifications

Antigen C22orf25
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias chromosome 22 open reading frame 25
Gene Symbols TANGO2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C22ORF25 The peptide sequence was selected from the N terminal of C22ORF25. Peptide sequence MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL.
Molecular Weight of Antigen 31 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 128989
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.