Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TANGO2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | C22orf25 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17046320
|
Novus Biologicals
NBP17046320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP170463
|
Novus Biologicals
NBP170463 |
100 μL |
Each for $499.50
|
|
|||||
Description
TANGO2 Polyclonal specifically detects TANGO2 in Human samples. It is validated for Western Blot.Specifications
| C22orf25 | |
| Polyclonal | |
| Rabbit | |
| chromosome 22 open reading frame 25 | |
| TANGO2 | |
| IgG | |
| 31 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 128989 | |
| Synthetic peptides corresponding to C22ORF25 The peptide sequence was selected from the N terminal of C22ORF25. Peptide sequence MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title