Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tapasin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159070
Description
Tapasin Polyclonal specifically detects Tapasin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Tapasin | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
TAPBP | |
Synthetic peptides corresponding to TAPBP (TAP binding protein (tapasin)) The peptide sequence was selected from the N terminal of TAPBP. Peptide sequence GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Pig: 92%; Rabbit: 92%; Mouse: 78%; Rat: 78%; Sheep: 78%. | |
Human, Mouse, Rat, Pig, Canine, Equine, Rabbit, Sheep | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
NGS17, NGS-17, TAP binding protein (tapasin), tapasin, TAPATAP-associated protein, TPN, TPSNTAP-binding protein | |
Rabbit | |
Affinity purified | |
RUO | |
6892 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction