Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tapasin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15907020UL
Description
Tapasin Polyclonal specifically detects Tapasin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Tapasin | |
Polyclonal | |
Western Blot 0.2-1 ug/ml, Immunohistochemistry | |
NGS17, NGS-17, TAP binding protein (tapasin), tapasin, TAPATAP-associated protein, TPN, TPSNTAP-binding protein | |
Rabbit | |
Affinity Purified | |
RUO | |
6892 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
TAPBP | |
Synthetic peptides corresponding to TAPBP (TAP binding protein (tapasin)) The peptide sequence was selected from the N terminal of TAPBP. Peptide sequence GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR. | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction