Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TARP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP174080
Description
TARP Polyclonal specifically detects TARP in Human samples. It is validated for Western Blot.Specifications
TARP | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CD3G, TARP TCR gamma alternate reading frame protein, TCRG, TCRGC1, TCRGC2 | |
Rabbit | |
13 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Horse: 86%; Mouse: 86%; Pig: 79%; Rat: 79%. | |
Human, Mouse, Rat, Pig, Equine | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q0VGM3 | |
TARP | |
Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK. | |
Affinity purified | |
RUO | |
445347 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction