Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TARP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
| Antigen | TARP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17408020
|
Novus Biologicals
NBP17408020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP174080
|
Novus Biologicals
NBP174080 |
100 μL |
Each for $501.50
|
|
|||||
Description
TARP Polyclonal specifically detects TARP in Human samples. It is validated for Western Blot.Specifications
| TARP | |
| Polyclonal | |
| Rabbit | |
| Q0VGM3 | |
| 445347 | |
| Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CD3G, TARP TCR gamma alternate reading frame protein, TCRG, TCRGC1, TCRGC2 | |
| TARP | |
| IgG | |
| 13 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title