Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TARP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17408020UL
Description
TARP Polyclonal specifically detects TARP in Human samples. It is validated for Western Blot.Specifications
TARP | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q0VGM3 | |
TARP | |
Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK. | |
Affinity Purified | |
RUO | |
445347 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CD3G, TARP TCR gamma alternate reading frame protein, TCRG, TCRGC1, TCRGC2 | |
Rabbit | |
13 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction