Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAS2R14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310050100UL
Description
TAS2R14 Polyclonal specifically detects TAS2R14 in Human samples. It is validated for Western Blot.Specifications
TAS2R14 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
MGC125491, T2R14MGC125492, Taste receptor family B member 1, taste receptor, family B, member 1, taste receptor, type 2, member 14, TRB1taste receptor type 2 member 14 | |
The immunogen is a synthetic peptide directed towards the C terminal region of human TAS2R14 (NP_076411.1). Peptide sequence MGMAYPSCHSCVLILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS | |
100 μg | |
GPCR, Protein Kinase | |
50840 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction