Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAS2R14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$518.50
Specifications
| Antigen | TAS2R14 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TAS2R14 Polyclonal specifically detects TAS2R14 in Human samples. It is validated for Western Blot.Specifications
| TAS2R14 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| GPCR, Protein Kinase | |
| PBS buffer, 2% sucrose | |
| 50840 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| MGC125491, T2R14MGC125492, Taste receptor family B member 1, taste receptor, family B, member 1, taste receptor, type 2, member 14, TRB1taste receptor type 2 member 14 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human TAS2R14 (NP_076411.1). Peptide sequence MGMAYPSCHSCVLILGNKKLRQASLSVLLWLRYMFKDGEPSGHKEFRESS | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title