Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TAS2R16 Rabbit anti-Human, Polyclonal, Novus Biologicals™

TAS2R16 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB123881 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB123881 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB123881 Supplier Novus Biologicals Supplier No. NBP309490100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TAS2R16 Polyclonal specifically detects TAS2R16 in Human samples. It is validated for Western Blot.

Specifications

Antigen TAS2R16
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias T2R16candidate taste receptor T2R16, taste receptor type 2 member 16, taste receptor, type 2, member 16
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAS2R16 (NP_058641). Peptide sequence TILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 50833
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.