TAS2R38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23371125UL

Catalog No. NB397364

Description

TAS2R38 Polyclonal specifically detects TAS2R38 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TAS2R38
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P59533
• Gene Symbols: TAS2R38
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NAKLRRAVMTILLWAQSSLKVRADHKADSRTL
• Quantity: 25 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 5726
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: PTCphenylthiocarbamide tasting, T2R38, T2R61PTC bitter taste receptor, taste receptor type 2 member 38, Taste receptor type 2 member 61, taste receptor, type 2, member 38
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only