Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TBC1D19 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16920220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16920220 20 μL
NBP169202 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16920220 Supplier Novus Biologicals Supplier No. NBP16920220UL

Rabbit Polyclonal Antibody

TBC1D19 Polyclonal specifically detects TBC1D19 in Human samples. It is validated for Western Blot.

Specifications

Antigen TBC1D19
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N5T2
Gene Alias FLJ11082, TBC1 domain family member 19, TBC1 domain family, member 19
Gene Symbols TBC1D19
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TBC1D19 (TBC1 domain family, member 19) The peptide sequence was selected from the middle region of TBC1D19. Peptide sequence PVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKEC.
Molecular Weight of Antigen 60 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55296
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.