Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TBCD Antibody, Novus Biologicals™

TBCD Antibody, Novus Biologicals™
SDP

Catalog No. NBP17991320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17991320 20 μL
NBP179913 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17991320 Supplier Novus Biologicals Supplier No. NBP17991320UL

Description

Rabbit Polyclonal Antibody

TBCD Polyclonal specifically detects TBCD in Human samples. It is validated for Western Blot.

Specifications

Antigen TBCD
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_005984
Gene Alias Beta-tubulin cofactor D, KIAA0988, SSD1, SSD-1, TFCD, tubulin folding cofactor D, Tubulin-folding cofactor D, tubulin-specific chaperone d
Gene Symbols TBCD
Host Species Rabbit
Immunogen The immunogen for this antibody is TBCD. Peptide sequence KLVQRLGLTFLKPKVAAWRYQRGCRSLAANLQLLTQGQSEQKPLILTEDD.
Molecular Weight of Antigen 131 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6904
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.