Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBCD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17991320UL
Description
TBCD Polyclonal specifically detects TBCD in Human samples. It is validated for Western Blot.Specifications
TBCD | |
Polyclonal | |
Western Blot 1:1000 | |
NP_005984 | |
TBCD | |
The immunogen for this antibody is TBCD. Peptide sequence KLVQRLGLTFLKPKVAAWRYQRGCRSLAANLQLLTQGQSEQKPLILTEDD. | |
Affinity Purified | |
RUO | |
6904 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Beta-tubulin cofactor D, KIAA0988, SSD1, SSD-1, TFCD, tubulin folding cofactor D, Tubulin-folding cofactor D, tubulin-specific chaperone d | |
Rabbit | |
131 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction