Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBCD Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | TBCD |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17991320
|
Novus Biologicals
NBP17991320UL |
20 μL |
Each for $152.22
|
|
NBP179913
|
Novus Biologicals
NBP179913 |
100 μL |
Each for $436.00
|
|
Description
TBCD Polyclonal specifically detects TBCD in Human samples. It is validated for Western Blot.Specifications
| TBCD | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NP_005984 | |
| 6904 | |
| The immunogen for this antibody is TBCD. Peptide sequence KLVQRLGLTFLKPKVAAWRYQRGCRSLAANLQLLTQGQSEQKPLILTEDD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Beta-tubulin cofactor D, KIAA0988, SSD1, SSD-1, TFCD, tubulin folding cofactor D, Tubulin-folding cofactor D, tubulin-specific chaperone d | |
| TBCD | |
| IgG | |
| Affinity Purified | |
| 131 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title