Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBCK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15634320UL
Description
TBCK Polyclonal specifically detects TBCK in Human samples. It is validated for Western Blot.Specifications
TBCK | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8TEA7-3 | |
TBCK | |
Synthetic peptides corresponding to MGC16169 The peptide sequence was selected from the middle region of MGC16169. Peptide sequence PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA. | |
20 μL | |
Protein Kinase | |
93627 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
HSPC302, MGC16169, TBC domain-containing protein kinase-like protein, TBC1 domain containing kinase, TBCKL | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction