Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBCK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TBCK |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156343
|
Novus Biologicals
NBP156343 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP15634320
|
Novus Biologicals
NBP15634320UL |
20 μL | N/A | N/A | N/A | ||||
Description
TBCK Polyclonal specifically detects TBCK in Human samples. It is validated for Western Blot.Specifications
| TBCK | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| HSPC302, MGC16169, TBC domain-containing protein kinase-like protein, TBC1 domain containing kinase, TBCKL | |
| TBCK | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TEA7-3 | |
| 93627 | |
| Synthetic peptides corresponding to MGC16169 The peptide sequence was selected from the middle region of MGC16169. Peptide sequence PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title