TBL2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP169369	100 μL

Catalog No. NBP169369 Supplier Novus Biologicals Supplier No. NBP169369

Description

Rabbit Polyclonal Antibody

TBL2 Polyclonal specifically detects TBL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TBL2
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9Y4P3
• Gene Alias: DKFZp434N024, DKFZP43N024, MGC134739, transducin (beta)-like 2, transducin beta-like protein 2, WBSCR13WS-betaTRPWS beta-transducin repeats protein, Williams-Beuren syndrome chromosomal region 13 protein, Williams-Beuren syndrome chromosome region 13
• Gene Symbols: TBL2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to TBL2(transducin (beta)-like 2) The peptide sequence was selected from the N terminal of TBL2. Peptide sequence RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK.
• Molecular Weight of Antigen: 49 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 26608
• Test Specificity: Expected identity based on immunogen sequence: Equine: 86%; Mouse: 85%, Rabbit: 86%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Equine, Rabbit
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only