Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBP like protein TLP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257783
Description
TBP like protein TLP Polyclonal specifically detects TBP like protein TLP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TBP like protein TLP | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
21 kDa TBP-like protein, STUD21-kDA TBP-like protein, TATA box binding protein-related factor 2, TATA box-binding protein-like protein 1, TATA box-binding protein-related factor 2, TBP-like 1, TBP-like factor, TBP-like protein 1, TBP-related factor 2, TBP-related protein, TLFMGC:8389, TLP21, TLPMGC:9620, TRF2Second TBP of unique DNA protein, TRP | |
Rabbit | |
Affinity Purified | |
RUO | |
9519 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TBPL1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction