Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBP like protein TLP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | TBP like protein TLP |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TBP like protein TLP Polyclonal specifically detects TBP like protein TLP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TBP like protein TLP | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 9519 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| 21 kDa TBP-like protein, STUD21-kDA TBP-like protein, TATA box binding protein-related factor 2, TATA box-binding protein-like protein 1, TATA box-binding protein-related factor 2, TBP-like 1, TBP-like factor, TBP-like protein 1, TBP-related factor 2, TBP-related protein, TLFMGC:8389, TLP21, TLPMGC:9620, TRF2Second TBP of unique DNA protein, TRP | |
| TBPL1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title