Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCEB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31794425UL
This item is not returnable.
View return policy
Description
TCEB2 Polyclonal antibody specifically detects TCEB2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
TCEB2 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
18-kD subunit, EloB, Elongin 18 kDa subunit, elongin-B, RNA polymerase II transcription factor SIII p18 subunit, RNA polymerase II transcription factor SIII subunit B, SIII p18, transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B), transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B), transcription elongation factor B polypeptide 2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS | |
25 μg | |
Cell Biology | |
6923 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction