Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCEB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
| Antigen | TCEB2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TCEB2 Polyclonal antibody specifically detects TCEB2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| TCEB2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS, pH 7.2, 40% glycerol | |
| 6923 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| 18-kD subunit, EloB, Elongin 18 kDa subunit, elongin-B, RNA polymerase II transcription factor SIII p18 subunit, RNA polymerase II transcription factor SIII subunit B, SIII p18, transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B), transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B), transcription elongation factor B polypeptide 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title