Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TCF-2/HNF-1 beta Antibody (CL0374), Novus Biologicals™
SDP

Catalog No. NBP230678 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP230678 0.1 mL
NB397690 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP230678 Supplier Novus Biologicals Supplier No. NBP230678
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

TCF-2/HNF-1 beta Monoclonal specifically detects TCF-2/HNF-1 beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen TCF-2/HNF-1 beta
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL0374
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Accession No. P35680
Gene Alias FJHN, hepatocyte nuclear factor 1-beta, HNF1 beta A, HNF1 homeobox B, HNF-1B, HNF1beta, HNF-1-beta, HNF2, Homeoprotein LFB3, LFB3, LF-B3, MODY5HPC11, TCF-2, TCF2transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor, Transcription factor 2, transcription factor 2, hepatic, Variant hepatic nuclear factor 1, vHNF1
Gene Symbols HNF1B
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Diabetes Research
Primary or Secondary Primary
Gene ID (Entrez) 6928
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.