Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TCF7L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310972100UL

 View more versions of this product

Catalog No. NB126843


Only null left
Add to Cart

Description

Description

TCF7L2 Polyclonal specifically detects TCF7L2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TCF7L2
Polyclonal
Western Blot 1.0 ug/ml
HMG box transcription factor 4, hTCF-4, T-cell factor 4, T-cell factor-4 variant A, T-cell factor-4 variant B, T-cell factor-4 variant C, T-cell factor-4 variant D, T-cell factor-4 variant E, T-cell factor-4 variant H, T-cell factor-4 variant I, T-cell factor-4 variant J, T-cell factor-4 variant K, T-cell factor-4 variant L, T-cell factor-4 variant M, T-cell factor-4 variant X2, T-cell-specific transcription factor 4, TCF-4T-cell factor-4 variant F, TCF4T-cell factor-4 variant G, transcription factor 7-like 2, transcription factor 7-like 2 (T-cell specific, HMG-box)
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L2 (NP_110383). Peptide sequence MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
100 μg
Cancer, Signal Transduction, Wnt Signaling Pathway
6934
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS buffer, 2% sucrose
Rabbit
Affinity purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.