TCF7L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB126843	Novus Biologicals NBP310972100UL	100 μg

Description

TCF7L2 Polyclonal specifically detects TCF7L2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TCF7L2
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cancer, Signal Transduction, Wnt Signaling Pathway
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 6934
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: HMG box transcription factor 4, hTCF-4, T-cell factor 4, T-cell factor-4 variant A, T-cell factor-4 variant B, T-cell factor-4 variant C, T-cell factor-4 variant D, T-cell factor-4 variant E, T-cell factor-4 variant H, T-cell factor-4 variant I, T-cell factor-4 variant J, T-cell factor-4 variant K, T-cell factor-4 variant L, T-cell factor-4 variant M, T-cell factor-4 variant X2, T-cell-specific transcription factor 4, TCF-4T-cell factor-4 variant F, TCF4T-cell factor-4 variant G, transcription factor 7-like 2, transcription factor 7-like 2 (T-cell specific, HMG-box)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7L2 (NP_110383). Peptide sequence MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN
• Purification Method: Affinity purified