TCL1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154693

Catalog No. NBP154693

Description

TCL1A Polyclonal specifically detects TCL1A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TCL1A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, T-cell leukemia/lymphoma 1A, T-cell lymphoma-1, T-cell lymphoma-1A, TCL1T-cell leukemia/lymphoma protein 1A
• Host Species: Rabbit
• Molecular Weight of Antigen: 13 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P56279
• Gene Symbols: TCL1A
• Immunogen: Synthetic peptides corresponding to TCL1A(T-cell leukemia/lymphoma 1A) The peptide sequence was selected from the N terminal of TCL1A. Peptide sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8115
• Target Species: Human
• Isotype: IgG