Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCL1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TCL1A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TCL1A Polyclonal specifically detects TCL1A in Human samples. It is validated for Western Blot.Specifications
TCL1A | |
Polyclonal | |
Rabbit | |
Human | |
Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, T-cell leukemia/lymphoma 1A, T-cell lymphoma-1, T-cell lymphoma-1A, TCL1T-cell leukemia/lymphoma protein 1A | |
TCL1A | |
IgG | |
13 kDa |
Western Blot | |
Unconjugated | |
RUO | |
P56279 | |
8115 | |
Synthetic peptides corresponding to TCL1A(T-cell leukemia/lymphoma 1A) The peptide sequence was selected from the N terminal of TCL1A. Peptide sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title