Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TCP10 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155165 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155165 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155165 Supplier Novus Biologicals Supplier No. NBP155165

Rabbit Polyclonal Antibody

TCP10 Polyclonal specifically detects TCP10 in Human samples. It is validated for Western Blot.

Specifications

Antigen TCP10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q12799
Gene Alias MGC34049, t-complex 10 (a murine tcp homolog), t-complex 10 (mouse), t-complex 10 homolog (mouse), T-complex protein 10A homolog, TCP10A
Gene Symbols TCP10
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TCP10(t-complex 10 homolog (mouse)) The peptide sequence was selected from the middle region of TCP10. Peptide sequence ERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAERRGVSEDGKIMH.
Molecular Weight of Antigen 35 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6953
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.