Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCP11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP157698
Description
TCP11 Polyclonal specifically detects TCP11 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockout Validated.Specifications
TCP11 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
D6S230E, KIAA0229, MGC111103, t-complex 11 (a murine tcp homolog), t-complex 11 homolog (mouse), T-complex protein 11 homolog | |
Rabbit | |
56 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot, Immunocytochemistry, Immunofluorescence, Immunoassay | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence, Knockout Validated | |
Q8WWU5 | |
TCP11 | |
Synthetic peptides corresponding to TCP11 (t-complex 11 homolog (mouse)) The peptide sequence was selected from the middle region of TCP11 (NP_061149). Peptide sequence CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL. | |
Affinity purified | |
RUO | |
6954 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction