Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TCP11 Antibody, Novus Biologicals™

TCP11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157698 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157698 100 μL
NBP15769820 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP157698 Supplier Novus Biologicals Supplier No. NBP157698
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 2 publications

TCP11 Polyclonal specifically detects TCP11 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockout Validated.

Specifications

Antigen TCP11
Applications Western Blot, Immunocytochemistry, Immunofluorescence, Immunoassay
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence, Knockout Validated
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8WWU5
Gene Alias D6S230E, KIAA0229, MGC111103, t-complex 11 (a murine tcp homolog), t-complex 11 homolog (mouse), T-complex protein 11 homolog
Gene Symbols TCP11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TCP11 (t-complex 11 homolog (mouse)) The peptide sequence was selected from the middle region of TCP11 (NP_061149). Peptide sequence CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6954
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.