TDRD9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157116

Catalog No. NBP157116

Description

TDRD9 Polyclonal specifically detects TDRD9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TDRD9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: TDRD9
• Immunogen: Synthetic peptides corresponding to TDRD9(tudor domain containing 9) The peptide sequence was selected from the middle region of TDRD9. Peptide sequence AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%; Chicken: 90%; Canine: 84%; Guinea pig: 84%; Equine: 84%; Pig: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C14orf75, chromosome 14 open reading frame 75, DKFZp434N0820, EC 3.6.1, EC 3.6.4.13, FLJ36164, HIG-1, hypoxia-inducible HIG-1, MGC135025, NET54, putative ATP-dependent RNA helicase TDRD9, tudor domain containing 9, Tudor domain-containing protein 9
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 122402
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.